PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zpz_sc00563.1.g00180.1.sm.mkhc
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family HD-ZIP
Protein Properties Length: 845aa    MW: 92609.1 Da    PI: 7.6224
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zpz_sc00563.1.g00180.1.sm.mkhcgenomeZGDView Nucleic Acid
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox57.81.8e-182582457
                                    -SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHC....TS-HHHHHHHHHHHHHHHHC CS
                        Homeobox  4 RttftkeqleeLeelFeknrypsaeereeLAkkl....gLterqVkvWFqNrRakekk 57
                                      ++t+eq+e+Le++++++++p+  +r++L +++    +++ +q+kvWFqNrR +ek+
  Zpz_sc00563.1.g00180.1.sm.mkhc 25 YVRYTPEQVEALERVYNECPKPTSLRRQQLIRECsilsNIEPKQIKVWFQNRRCREKQ 82
                                    6789****************************************************97 PP

2START160.61.2e-501743812204
                                     HHHHHHHHHHHHHHHC-TT-EEEEEXCCTTEEEEEEESSS.SCEEEEEEEECCSCHHHHHHHHHCCCGGCT-TT-SEEE CS
                           START   2 laeeaaqelvkkalaeepgWvkssesengdevlqkfeeskvdsgealrasgvvdmvlallveellddkeqWdetlakae 80 
                                     +aee+++e+++ka+ +  +Wv+++ +++g++++ +++ s++++g a+ra+g+v  +++  v+e+l+d+  W +++++++
  Zpz_sc00563.1.g00180.1.sm.mkhc 174 IAEETLAEFMSKATGTVVNWVQMVGMKPGPDSIGIIAVSHNSRGVAARACGLVSLEPT-KVAEILKDRVSWYRDCRRVD 251
                                     68999*****************************************************.7777777777********** PP

                                     EEEEECTT..EEEEEEEEXXTTXX-SSX.EEEEEEEEEEE.TTS-EEEEEEEEE-TTS--....-TTSEE-EESSEEEE CS
                           START  81 tlevissg..galqlmvaelqalsplvp.RdfvfvRyirqlgagdwvivdvSvdseqkppe...sssvvRaellpSgil 153
                                     +l vi +g  g+++l++++++a+++l+  Rdf+++Ry+ +l +g++vi+++S++  +  p    s +++RaellpSg+l
  Zpz_sc00563.1.g00180.1.sm.mkhc 252 ILHVIPTGngGTIELIYMQTYAPTTLAEpRDFWTLRYTSCLDDGSLVICERSLTKSTGGPLgpnSLNFIRAELLPSGYL 330
                                     ***********************999866******************************9999999************* PP

                                     EEEECTCEEEEEEEE-EE--SSXXHHHHHHHHHHHHHHHHHHHHHHTXXXX CS
                           START 154 iepksnghskvtwvehvdlkgrlphwllrslvksglaegaktwvatlqrqc 204
                                     i+p+++g+s + +v+hvdl++ ++++++r+l++s  + ++k+++a+l++ +
  Zpz_sc00563.1.g00180.1.sm.mkhc 331 IRPCEGGGSMIYIVDHVDLDACSVPEVIRPLYESPKILAQKMTLAALRHIR 381
                                     ***********************************************9865 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5007115.371983IPR001356Homeobox domain
SMARTSM003891.8E-162187IPR001356Homeobox domain
SuperFamilySSF466893.94E-172385IPR009057Homeodomain-like
CDDcd000861.00E-162484No hitNo description
PfamPF000465.5E-162582IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.601.7E-182682IPR009057Homeodomain-like
CDDcd146864.89E-676115No hitNo description
PROSITE profilePS5084824.456164364IPR002913START domain
CDDcd088758.38E-66168384No hitNo description
Gene3DG3DSA:3.30.530.202.7E-20173355IPR023393START-like domain
SMARTSM002345.0E-42173383IPR002913START domain
PfamPF018529.2E-49174381IPR002913START domain
SuperFamilySSF559612.06E-34174383No hitNo description
PfamPF086706.6E-29708845IPR013978MEKHLA
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0008289Molecular Functionlipid binding
Sequence ? help Back to Top
Protein Sequence    Length: 845 aa     Download sequence    Send to blast
MAAVASRERR RLSPASAPHV DTGKYVRYTP EQVEALERVY NECPKPTSLR RQQLIRECSI  60
LSNIEPKQIK VWFQNRRCRE KQRKESSRLQ TVNRKLSAMN KLLMEENDRL QKQVSGLVND  120
NGLMRNRLHK PSAATTDTSC ESVVTSGQPH LQQNPPVPHP PQRDANIPAG LLAIAEETLA  180
EFMSKATGTV VNWVQMVGMK PGPDSIGIIA VSHNSRGVAA RACGLVSLEP TKVAEILKDR  240
VSWYRDCRRV DILHVIPTGN GGTIELIYMQ TYAPTTLAEP RDFWTLRYTS CLDDGSLVIC  300
ERSLTKSTGG PLGPNSLNFI RAELLPSGYL IRPCEGGGSM IYIVDHVDLD ACSVPEVIRP  360
LYESPKILAQ KMTLAALRHI RQIAFESSGE IPYGAGRQPA VLRTISQRLS RGFNDAVSGF  420
PDDGWSLLSR EGSEDITISV KSSPNKLDGF HVSTSPFFSA FGGGIMCAKA SMLIQNVPPA  480
LLVRFLREHR SQWADPGVDA YSAASLRTGP YAVPGLGSCG FTGSQAMVPL AETIDHEESL  540
EIVRFEGNGF GHNDVVLSRD MLLLQLCSGA DESVPGACAQ LVYAPIDDGF SDDAQLLPSG  600
FRVVPLDGKV DVLLATRTLD LASALEVGSG ETLHVSKDTA GLDNMRSVLT IAFQFSFENH  660
LRESVAVMAR QYVRSVMSSV QRVAMAISPH IGTQIKMKHQ PGSPEAQTLA RWISRSYKVH  720
AGAEIRWSDS KDADSPLKLL WKHSDAILCC SLKASPMLMF ANSAGLDILE TTLINIQDMP  780
LETVLGDEGQ KALVLELPKI MNQYSWRLAA LPFLSCQQGF TNLPTGVCKS SMGRLVSYEQ  840
AAVWK
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004963232.10.0PREDICTED: homeobox-leucine zipper protein HOX33-like
SwissprotA2ZMN90.0HOX33_ORYSI; Homeobox-leucine zipper protein HOX33
SwissprotQ2QM960.0HOX33_ORYSJ; Homeobox-leucine zipper protein HOX33
TrEMBLK3Z3T30.0K3Z3T3_SETIT; Uncharacterized protein
STRINGSi021201m0.0(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP37438197
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G34710.10.0HD-ZIP family protein